PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009612238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 284aa    MW: 32228.2 Da    PI: 6.7047
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009612238.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.7e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEd++l+  ++++G ++W++ ++  g+ R +k+c++rw +yl
   XP_009612238.1 16 KGPWSCEEDLRLISFIQKHGHPNWRSLPKQAGLLRRGKSCRLRWINYL 63
                     79******************************99************97 PP

2Myb_DNA-binding51.81.8e-1669112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE+  +v++++ lG++ W++Ia++++ gRt++++k+ w++
   XP_009612238.1  69 RGNFTPEEEYTIVKLHHSLGNK-WSKIASHLP-GRTDNEIKNIWNT 112
                      89********************.*********.*********9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-22866IPR009057Homeodomain-like
PROSITE profilePS5129413.5641163IPR017930Myb domain
SuperFamilySSF466894.12E-2914110IPR009057Homeodomain-like
SMARTSM007171.1E-101565IPR001005SANT/Myb domain
PfamPF002491.8E-131663IPR001005SANT/Myb domain
CDDcd001676.03E-81863No hitNo description
PROSITE profilePS5129423.0964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2667117IPR009057Homeodomain-like
SMARTSM007174.5E-1468116IPR001005SANT/Myb domain
PfamPF002494.1E-1569112IPR001005SANT/Myb domain
CDDcd001671.26E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MRKGRAACCD KGKVKKGPWS CEEDLRLISF IQKHGHPNWR SLPKQAGLLR RGKSCRLRWI  60
NYLRPDVKRG NFTPEEEYTI VKLHHSLGNK WSKIASHLPG RTDNEIKNIW NTRLKKRFKN  120
AELDGCANSF SPPSSSTSVV SHTANEGEFK NVNDDNMITE KEASKSCSPT SSYASNLSNL  180
SQVEISGPNV DMDWIFQLNE EPNLEYFPCI TAGKVHDNEG MIEIPLEGSG IDFWDMLDIM  240
SPSPNSESKL DNHSEGSDQP VCQGISEFEC QNWMRYFENE LGLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-26161184105MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-26161184105C-Myb DNA-Binding Domain
1msf_C3e-26161184105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612238.10.0PREDICTED: myb-related protein 340-like
TrEMBLM1DHZ06e-96M1DHZ0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000893422e-95(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.17e-73myb domain protein 63